SCOP 1.57: Domain d4euga_: 4eug A:

Lineage for d4euga_ (4eug A:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)

4. Superfamily c.18.1: DNA glycosylase [52141] (2 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Escherichia coli [TaxId:562] [52146] (9 PDB entries)

8. Domain d4euga_: 4eug A: [31019]

Details for d4euga_

PDB Entry: 4eug, 1.4 Å

PDB Description: crystallographic and enzymatic studies of an active site variant h187q of escherichia coli uracil dna glycosylase: crystal structures of mutant h187q and its uracil complex

SCOP Domain Sequences for d4euga_:

Sequence; same for both SEQRES and ATOM records:

>d4euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
ltwhdvlaeekqqpyflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
apqpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

Timeline for d4euga_:

• d4euga_ first appeared (with stable ids) in SCOP 1.55
  
• d4euga_ appears in SCOP 1.59
  
• d4euga_ appears in the current release, SCOPe 2.08