Lineage for d5apha1 (5aph A:265-507)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2729984Domain d5apha1: 5aph A:265-507 [310187]
    Other proteins in same PDB: d5apha2, d5apha3
    automated match to d4qm0c_
    complexed with dms, vyi

Details for d5apha1

PDB Entry: 5aph (more details), 1.54 Å

PDB Description: ligand complex of rorg lbd
PDB Compounds: (A:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5apha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5apha1 a.123.1.0 (A:265-507) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aslteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhl
teaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkygg
melfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqy
nlelafhhhlckthrqsilaklppkgklrslcsqhverlqifqhlhpivvqaafpplyke
lfs

SCOPe Domain Coordinates for d5apha1:

Click to download the PDB-style file with coordinates for d5apha1.
(The format of our PDB-style files is described here.)

Timeline for d5apha1: