SCOP 1.71: Domain d3euga_: 3eug A:

Lineage for d3euga_ (3eug A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (3 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (4 species)

7. Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)

8. Domain d3euga_: 3eug A: [31018]
   complexed with gol; mutant

Details for d3euga_

PDB Entry: 3eug, 1.43 Å

PDB Description: crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited

SCOP Domain Sequences for d3euga_:

Sequence; same for both SEQRES and ATOM records:

>d3euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
ltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
aphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

Timeline for d3euga_:

• d3euga_ first appeared (with stable ids) in SCOP 1.55
  
• d3euga_ appears in SCOP 1.69
  
• d3euga_ appears in SCOP 1.73
  
• d3euga_ appears in the current release, SCOPe 2.08