Lineage for d3euga_ (3eug A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21711Fold c.18: DNA glycosylase [52140] (1 superfamily)
  4. 21712Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 21713Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 21714Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 21715Species Escherichia coli [TaxId:562] [52146] (9 PDB entries)
  8. 21716Domain d3euga_: 3eug A: [31018]

Details for d3euga_

PDB Entry: 3eug (more details), 1.43 Å

PDB Description: crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited

SCOP Domain Sequences for d3euga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli}
ltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
aphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

SCOP Domain Coordinates for d3euga_:

Click to download the PDB-style file with coordinates for d3euga_.
(The format of our PDB-style files is described here.)

Timeline for d3euga_: