Lineage for d3euga_ (3eug A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855020Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2855021Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2855022Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2855023Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2855038Species Escherichia coli [TaxId:562] [52146] (12 PDB entries)
  8. 2855040Domain d3euga_: 3eug A: [31018]
    protein/DNA complex; complexed with gol

Details for d3euga_

PDB Entry: 3eug (more details), 1.43 Å

PDB Description: crystal structure of escherichia coli uracil dna glycosylase and its complexes with uracil and glycerol: structure and glycosylase mechanism revisited
PDB Compounds: (A:) protein (glycosylase)

SCOPe Domain Sequences for d3euga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3euga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Escherichia coli [TaxId: 562]}
ltwhdvlaeekqqphflntlqtvaserqsgvtiyppqkdvfnafrftelgdvkvvilgqd
pyhgpgqahglafsvrpgiaippsllnmykelentipgftrpnhgyleswarqgvlllnt
vltvragqahshaslgwetftdkvislinqhregvvfllwgshaqkkgaiidkqrhhvlk
aphpsplsahrgffgcnhfvlanqwleqhgetpidwmpvlpaese

SCOPe Domain Coordinates for d3euga_:

Click to download the PDB-style file with coordinates for d3euga_.
(The format of our PDB-style files is described here.)

Timeline for d3euga_: