Lineage for d5ahjq1 (5ahj Q:1-234)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2995913Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [226129] (16 PDB entries)
  8. 2995941Domain d5ahjq1: 5ahj Q:1-234 [310178]
    Other proteins in same PDB: d5ahja_, d5ahjb_, d5ahjc2, d5ahjd_, d5ahje_, d5ahjf_, d5ahjg_, d5ahjh_, d5ahji_, d5ahjj_, d5ahjk_, d5ahjl_, d5ahjm_, d5ahjn_, d5ahjo_, d5ahjp_, d5ahjq2, d5ahjr_, d5ahjs_, d5ahjt_, d5ahju_, d5ahjv_, d5ahjw_, d5ahjx_, d5ahjy_, d5ahjz_
    automated match to d4eu2a_
    complexed with 7im, cl, mes, mg

Details for d5ahjq1

PDB Entry: 5ahj (more details), 2.8 Å

PDB Description: yeast 20s proteasome in complex with macyranone a
PDB Compounds: (Q:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5ahjq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ahjq1 d.153.1.0 (Q:1-234) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqi

SCOPe Domain Coordinates for d5ahjq1:

Click to download the PDB-style file with coordinates for d5ahjq1.
(The format of our PDB-style files is described here.)

Timeline for d5ahjq1: