SCOP 1.71: Domain d1udie_: 1udi E:

Lineage for d1udie_ (1udi E:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (3 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (4 species)

7. Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries)

8. Domain d1udie_: 1udi E: [31017]
   Other proteins in same PDB: d1udii_

Details for d1udie_

PDB Entry: 1udi, 2.7 Å

PDB Description: nucleotide mimicry in the crystal structure of the uracil-dna glycosylase-uracil glycosylase inhibitor protein complex

SCOP Domain Sequences for d1udie_:

Sequence; same for both SEQRES and ATOM records:

>d1udie_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1}
dwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryctp
devrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgclek
wardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnair
pdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

Timeline for d1udie_:

• d1udie_ first appeared (with stable ids) in SCOP 1.55
  
• d1udie_ appears in SCOP 1.69
  
• d1udie_ appears in SCOP 1.73
  
• d1udie_ appears in the current release, SCOPe 2.08