Lineage for d1udie_ (1udi E:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 578428Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 578429Superfamily c.18.1: DNA glycosylase [52141] (3 families) (S)
  5. 578430Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 578431Protein Uracil-DNA glycosylase [52143] (4 species)
  7. 578458Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries)
  8. 578462Domain d1udie_: 1udi E: [31017]
    Other proteins in same PDB: d1udii_

Details for d1udie_

PDB Entry: 1udi (more details), 2.7 Å

PDB Description: nucleotide mimicry in the crystal structure of the uracil-dna glycosylase-uracil glycosylase inhibitor protein complex

SCOP Domain Sequences for d1udie_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1udie_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1}
dwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryctp
devrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgclek
wardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnair
pdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

SCOP Domain Coordinates for d1udie_:

Click to download the PDB-style file with coordinates for d1udie_.
(The format of our PDB-style files is described here.)

Timeline for d1udie_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1udii_