Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.18: DNA glycosylase [52140] (1 superfamily) |
Superfamily c.18.1: DNA glycosylase [52141] (2 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
Protein Uracil-DNA glycosylase [52143] (3 species) |
Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries) |
Domain d1udie_: 1udi E: [31017] Other proteins in same PDB: d1udii_ |
PDB Entry: 1udi (more details), 2.7 Å
SCOP Domain Sequences for d1udie_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udie_ c.18.1.1 (E:) Uracil-DNA glycosylase {Herpes simplex virus type 1} dwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryctp devrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgclek wardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnair pdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
Timeline for d1udie_: