SCOPe 2.07: Domain d5agyb2: 5agy B:84-219

Lineage for d5agyb2 (5agy B:84-219)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (65 species)
   not a true protein

7. Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries)

8. Domain d5agyb2: 5agy B:84-219 [310162]
   Other proteins in same PDB: d5agya1, d5agya3, d5agyb1
   automated match to d4chsb2
   complexed with 4nm, gtb, po4; mutant

Details for d5agyb2

PDB Entry: 5agy, 1.75 Å

PDB Description: crystal structure of a tau class gst mutant from glycine

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d5agyb2:

Sequence; same for both SEQRES and ATOM records:

>d5agyb2 a.45.1.0 (B:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]}
llpsdpyqraqtrfwadyvdkkiydlgrkictskgeekeaakkefiealklleeqlgdkt
yfggdnlgfvdialvpfytwfkayetfgtlniesecpkfvawakrclqkesvakslpdqq
kvyefimdlrkklgie

Timeline for d5agyb2:

• d5agyb2 first appeared in SCOPe 2.06