Lineage for d5agyb2 (5agy B:84-219)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714230Species Soybean (Glycine max) [TaxId:3847] [225580] (5 PDB entries)
  8. 2714234Domain d5agyb2: 5agy B:84-219 [310162]
    Other proteins in same PDB: d5agya1, d5agya3, d5agyb1
    automated match to d4chsb2
    complexed with 4nm, gtb, po4; mutant

Details for d5agyb2

PDB Entry: 5agy (more details), 1.75 Å

PDB Description: crystal structure of a tau class gst mutant from glycine
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d5agyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5agyb2 a.45.1.0 (B:84-219) automated matches {Soybean (Glycine max) [TaxId: 3847]}
llpsdpyqraqtrfwadyvdkkiydlgrkictskgeekeaakkefiealklleeqlgdkt
yfggdnlgfvdialvpfytwfkayetfgtlniesecpkfvawakrclqkesvakslpdqq
kvyefimdlrkklgie

SCOPe Domain Coordinates for d5agyb2:

Click to download the PDB-style file with coordinates for d5agyb2.
(The format of our PDB-style files is described here.)

Timeline for d5agyb2: