| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Soybean (Glycine max) [TaxId:3847] [225579] (5 PDB entries) |
| Domain d5agyb1: 5agy B:3-83 [310161] Other proteins in same PDB: d5agya2, d5agya3, d5agyb2 automated match to d4chsb1 complexed with 4nm, gtb, po4; mutant |
PDB Entry: 5agy (more details), 1.75 Å
SCOPe Domain Sequences for d5agyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5agyb1 c.47.1.0 (B:3-83) automated matches {Soybean (Glycine max) [TaxId: 3847]}
devvlldfwpspfgmrvrialaekgikyeykeedlqnksplllkmnpvhkkipvlihngk
picesliavqyieevwndrnp
Timeline for d5agyb1: