| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) ![]() |
| Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
| Protein Uracil-DNA glycosylase [52143] (5 species) |
| Species Herpes simplex virus type 1 [TaxId:10298] [52145] (4 PDB entries) |
| Domain d1udga_: 1udg A: [31016] complexed with so4 |
PDB Entry: 1udg (more details), 1.75 Å
SCOPe Domain Sequences for d1udga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1udga_ c.18.1.1 (A:) Uracil-DNA glycosylase {Herpes simplex virus type 1 [TaxId: 10298]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
Timeline for d1udga_: