SCOPe 2.06: Domain d5acsb_: 5acs B:

Lineage for d5acsb_ (5acs B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (18 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187706] (16 PDB entries)

8. Domain d5acsb_: 5acs B: [310153]
   automated match to d4f6ha_
   complexed with zn

Details for d5acsb_

PDB Entry: 5acs, 1.46 Å

PDB Description: y233a-investigation of the impact from residues w228 and y233 in the metallo-beta-lactamase gim-1

PDB Compounds: (B:) gim-1 protein

SCOPe Domain Sequences for d5acsb_:

Sequence; same for both SEQRES and ATOM records:

>d5acsb_ d.157.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat
drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft
lgnglielyypgaghtednivawlpkskilfggclvrsheweglgavgdasisswadsik
nivskkypiqmvvpghgkvgssdildhtidlaesasn

Timeline for d5acsb_:

• d5acsb_ is new in SCOPe 2.06-stable
  
• d5acsb_ appears in SCOPe 2.07
  
• d5acsb_ appears in the current release, SCOPe 2.08