SCOPe 2.07: Domain d5acra_: 5acr A:

Lineage for d5acra_ (5acr A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (31 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries)

8. Domain d5acra_: 5acr A: [310150]
   automated match to d4f6za_
   complexed with ca, zn

Details for d5acra_

PDB Entry: 5acr, 1.9 Å

PDB Description: w228y-investigation of the impact from residues w228 and y233 in the metallo-beta-lactamase gim-1

PDB Compounds: (A:) gim-1 protein

SCOPe Domain Sequences for d5acra_:

Sequence; same for both SEQRES and ATOM records:

>d5acra_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat
drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft
lgnglielyypgaghtednivawlpkskilfggclvrsheyeglgyvgdasisswadsik
nivskkypiqmvvpghgkvgssdildhtidlaesasn

Timeline for d5acra_:

• d5acra_ first appeared in SCOPe 2.06
  
• d5acra_ appears in the current release, SCOPe 2.08