Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (18 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:287] [187706] (16 PDB entries) |
Domain d5acpa_: 5acp A: [310146] automated match to d4f6ha_ complexed with mg, zn |
PDB Entry: 5acp (more details), 1.98 Å
SCOPe Domain Sequences for d5acpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5acpa_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} ghkplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllsw atdrgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkdde ftlgnglielyypgaghtednivawlpkskilfggclvrshereglgyvgdasisswads iknivskkypiqmvvpghgkvgssdildhtidlaesasn
Timeline for d5acpa_: