Lineage for d5a6rd_ (5a6r D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2945442Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 2945443Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 2945784Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 2945785Protein automated matches [190710] (5 species)
    not a true protein
  7. 2945786Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)
  8. 2945916Domain d5a6rd_: 5a6r D: [310140]
    automated match to d5bxbc_

Details for d5a6rd_

PDB Entry: 5a6r (more details), 2.85 Å

PDB Description: crystal structure of the btb domain of human kctd17
PDB Compounds: (D:) btb/poz domain-containing protein kctd17

SCOPe Domain Sequences for d5a6rd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a6rd_ d.42.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wgkwvrlnvggtvflttrqtlcreqksflsrlcqgeelqsdrdetgaylidrdptyfgpi
lnflrhgklvldkdmaeegvleeaefynigpliriikdrme

SCOPe Domain Coordinates for d5a6rd_:

Click to download the PDB-style file with coordinates for d5a6rd_.
(The format of our PDB-style files is described here.)

Timeline for d5a6rd_: