Class b: All beta proteins [48724] (180 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins) duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains |
Protein automated matches [310893] (1 species) not a true protein |
Species CPMV (Cowpea mosaic virus) [TaxId:12264] [311486] (2 PDB entries) |
Domain d5a33b2: 5a33 B:183-367 [310136] automated match to d1ny722 |
PDB Entry: 5a33 (more details), 3.04 Å
SCOPe Domain Sequences for d5a33b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5a33b2 b.121.4.2 (B:183-367) automated matches {CPMV (Cowpea mosaic virus) [TaxId: 12264]} hladcqnwlplnrwmgkltfpqgvtsevrrmplsigggagatqaflanmpnswismwryf rgelhfevtkmsspyikatvtfliafgnlsdafgfyesfphrivqfaeveekctlvfsqq efvtawstqvnprttleadgcpylyaiihdsttgtisgdfnlgvklvgikdfcgigsnpg idgsr
Timeline for d5a33b2: