Lineage for d5a33b2 (5a33 B:183-367)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822235Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins)
    duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains
  6. 2822259Protein automated matches [310893] (1 species)
    not a true protein
  7. 2822260Species CPMV (Cowpea mosaic virus) [TaxId:12264] [311486] (2 PDB entries)
  8. 2822266Domain d5a33b2: 5a33 B:183-367 [310136]
    automated match to d1ny722

Details for d5a33b2

PDB Entry: 5a33 (more details), 3.04 Å

PDB Description: electron cryo-microscopy of cowpea mosaic virus (cpmv) empty virus like particle (evlp)
PDB Compounds: (B:) rna2 polyprotein

SCOPe Domain Sequences for d5a33b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5a33b2 b.121.4.2 (B:183-367) automated matches {CPMV (Cowpea mosaic virus) [TaxId: 12264]}
hladcqnwlplnrwmgkltfpqgvtsevrrmplsigggagatqaflanmpnswismwryf
rgelhfevtkmsspyikatvtfliafgnlsdafgfyesfphrivqfaeveekctlvfsqq
efvtawstqvnprttleadgcpylyaiihdsttgtisgdfnlgvklvgikdfcgigsnpg
idgsr

SCOPe Domain Coordinates for d5a33b2:

Click to download the PDB-style file with coordinates for d5a33b2.
(The format of our PDB-style files is described here.)

Timeline for d5a33b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5a33b1
View in 3D
Domains from other chains:
(mouse over for more information)
d5a33a_