SCOPe 2.08: Domain d5a33b1: 5a33 B:1-182

Lineage for d5a33b1 (5a33 B:1-182)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.2: Comoviridae-like VP [88636] (3 proteins)
   duplication: mature coat protein consists of three similar domains that can be in a single chain or in two separate chains

6. Protein automated matches [310893] (1 species)
   not a true protein

7. Species CPMV (Cowpea mosaic virus) [TaxId:12264] [311486] (2 PDB entries)

8. Domain d5a33b1: 5a33 B:1-182 [310135]
   automated match to d1ny721

Details for d5a33b1

PDB Entry: 5a33, 3.04 Å

PDB Description: electron cryo-microscopy of cowpea mosaic virus (cpmv) empty virus like particle (evlp)

PDB Compounds: (B:) rna2 polyprotein

SCOPe Domain Sequences for d5a33b1:

Sequence; same for both SEQRES and ATOM records:

>d5a33b1 b.121.4.2 (B:1-182) automated matches {CPMV (Cowpea mosaic virus) [TaxId: 12264]}
meqnlfalslddtssvrgslldtkfaqtrvllskamaggdvlldeylydvvngqdfratv
aflrthvitgkikvtattnisdnsgcclmlainsgvrgkystdvyticsqdsmtwnpgck
knfsftfnpnpcgdswsaemisrsrvrmtvicvsgwtlspttdviakldwsivnekcept
iy

Timeline for d5a33b1:

• d5a33b1 first appeared in SCOPe 2.06
  
• d5a33b1 appears in SCOPe 2.07