Lineage for d4zysa2 (4zys A:126-226)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934586Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2934587Protein automated matches [226841] (6 species)
    not a true protein
  7. 2934606Species Staphylococcus aureus [TaxId:158878] [224923] (3 PDB entries)
  8. 2934611Domain d4zysa2: 4zys A:126-226 [310132]
    Other proteins in same PDB: d4zysa1, d4zysb1
    automated match to d4o1na2
    complexed with cl

Details for d4zysa2

PDB Entry: 4zys (more details), 2.25 Å

PDB Description: crystal structure of an exotoxin 6 (sav0422) from staphylococcus aureus subsp. aureus mu50 at 2.25 a resolution
PDB Compounds: (A:) exotoxin 6

SCOPe Domain Sequences for d4zysa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zysa2 d.15.6.0 (A:126-226) automated matches {Staphylococcus aureus [TaxId: 158878]}
pfidyihtpileikkgkeepqsslyqiykedislkeldyrlreraikqhglysnglkqgq
ititmkdgkshtidlsqklekermgdsidgrqiqkilvemk

SCOPe Domain Coordinates for d4zysa2:

Click to download the PDB-style file with coordinates for d4zysa2.
(The format of our PDB-style files is described here.)

Timeline for d4zysa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zysa1