![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
![]() | Protein automated matches [226841] (6 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [224923] (3 PDB entries) |
![]() | Domain d4zysa2: 4zys A:126-226 [310132] Other proteins in same PDB: d4zysa1, d4zysb1 automated match to d4o1na2 complexed with cl |
PDB Entry: 4zys (more details), 2.25 Å
SCOPe Domain Sequences for d4zysa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zysa2 d.15.6.0 (A:126-226) automated matches {Staphylococcus aureus [TaxId: 158878]} pfidyihtpileikkgkeepqsslyqiykedislkeldyrlreraikqhglysnglkqgq ititmkdgkshtidlsqklekermgdsidgrqiqkilvemk
Timeline for d4zysa2: