Lineage for d4zysa1 (4zys A:32-125)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381771Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2382641Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 2382642Protein automated matches [226834] (5 species)
    not a true protein
  7. 2382661Species Staphylococcus aureus [TaxId:158878] [224865] (3 PDB entries)
  8. 2382666Domain d4zysa1: 4zys A:32-125 [310131]
    Other proteins in same PDB: d4zysa2, d4zysb2
    automated match to d4o1nd1
    complexed with cl

Details for d4zysa1

PDB Entry: 4zys (more details), 2.25 Å

PDB Description: crystal structure of an exotoxin 6 (sav0422) from staphylococcus aureus subsp. aureus mu50 at 2.25 a resolution
PDB Compounds: (A:) exotoxin 6

SCOPe Domain Sequences for d4zysa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zysa1 b.40.2.0 (A:32-125) automated matches {Staphylococcus aureus [TaxId: 158878]}
tevkqqseselkhyynkpvlerknvtgykytekgkdyidvivdnqysqislvgsdkdkfk
dgdnsnidvfilregdsrqatnysiggvtktnsq

SCOPe Domain Coordinates for d4zysa1:

Click to download the PDB-style file with coordinates for d4zysa1.
(The format of our PDB-style files is described here.)

Timeline for d4zysa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zysa2