SCOP 1.63: Domain d4skne_: 4skn E:

Lineage for d4skne_ (4skn E:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (2 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries)

8. Domain d4skne_: 4skn E: [31013]
   complexed with d1p, ura; mutant

Details for d4skne_

PDB Entry: 4skn, 2.9 Å

PDB Description: a nucleotide-flipping mechanism from the structure of human uracil-dna glycosylase bound to dna

SCOP Domain Sequences for d4skne_:

Sequence; same for both SEQRES and ATOM records:

>d4skne_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqnpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsprsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d4skne_:

• d4skne_ first appeared (with stable ids) in SCOP 1.55
  
• d4skne_ appears in SCOP 1.61
  
• d4skne_ appears in SCOP 1.65
  
• d4skne_ appears in the current release, SCOPe 2.08, called d4skne1