SCOPe 2.07: Domain d4skne1: 4skn E:85-304

Lineage for d4skne1 (4skn E:85-304)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (15 PDB entries)

8. Domain d4skne1: 4skn E:85-304 [31013]
   Other proteins in same PDB: d4skne2
   protein/DNA complex; complexed with ura

Details for d4skne1

PDB Entry: 4skn, 2.9 Å

PDB Description: a nucleotide-flipping mechanism from the structure of human uracil-dna glycosylase bound to dna

PDB Compounds: (E:) protein (uracil-DNA glycosylase)

SCOPe Domain Sequences for d4skne1:

Sequence; same for both SEQRES and ATOM records:

>d4skne1 c.18.1.1 (E:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
npyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsprsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d4skne1:

• d4skne1 first appeared (with stable ids) in SCOP 1.55, called d4skne_
  
• d4skne1 appears in SCOPe 2.06