Lineage for d4skne1 (4skn E:85-304)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101206Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2101207Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2101208Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 protein domains)
  6. 2101209Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2101252Species Human (Homo sapiens) [TaxId:9606] [52144] (15 PDB entries)
  8. 2101265Domain d4skne1: 4skn E:85-304 [31013]
    Other proteins in same PDB: d4skne2
    protein/DNA complex; complexed with ura

Details for d4skne1

PDB Entry: 4skn (more details), 2.9 Å

PDB Description: a nucleotide-flipping mechanism from the structure of human uracil-dna glycosylase bound to dna
PDB Compounds: (E:) protein (uracil-DNA glycosylase)

SCOPe Domain Sequences for d4skne1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4skne1 c.18.1.1 (E:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
npyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsprsvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d4skne1:

Click to download the PDB-style file with coordinates for d4skne1.
(The format of our PDB-style files is described here.)

Timeline for d4skne1: