Lineage for d2sspe_ (2ssp E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114317Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 2114318Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 2114319Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 2114320Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 2114363Species Human (Homo sapiens) [TaxId:9606] [52144] (15 PDB entries)
  8. 2114375Domain d2sspe_: 2ssp E: [31012]
    protein/DNA complex

Details for d2sspe_

PDB Entry: 2ssp (more details), 2.25 Å

PDB Description: leucine-272-alanine uracil-dna glycosylase bound to abasic site-containing dna
PDB Compounds: (E:) protein (uracil-DNA glycosylase)

SCOPe Domain Sequences for d2sspe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2sspe_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpspasvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d2sspe_:

Click to download the PDB-style file with coordinates for d2sspe_.
(The format of our PDB-style files is described here.)

Timeline for d2sspe_: