SCOP 1.63: Domain d2sspe_: 2ssp E:

Lineage for d2sspe_ (2ssp E:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: DNA glycosylase [52141] (2 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries)

8. Domain d2sspe_: 2ssp E: [31012]
   complexed with d1p; mutant

Details for d2sspe_

PDB Entry: 2ssp, 2.25 Å

PDB Description: leucine-272-alanine uracil-dna glycosylase bound to abasic site-containing dna

SCOP Domain Sequences for d2sspe_:

Sequence; same for both SEQRES and ATOM records:

>d2sspe_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpspasvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d2sspe_:

• d2sspe_ first appeared (with stable ids) in SCOP 1.55
  
• d2sspe_ appears in SCOP 1.61
  
• d2sspe_ appears in SCOP 1.65
  
• d2sspe_ appears in the current release, SCOPe 2.08