Lineage for d4zu6x_ (4zu6 X:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139874Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 2139881Species Haemophilus influenzae [TaxId:727] [142746] (3 PDB entries)
    Uniprot P45040 2-311
  8. 2139884Domain d4zu6x_: 4zu6 X: [310118]
    complexed with oas, plp

Details for d4zu6x_

PDB Entry: 4zu6 (more details), 2.03 Å

PDB Description: crystal structure of o-acetylserine sulfhydrylase from haemophilus influenzae in complex with pre-reactive o-acetyl serine, alpha- aminoacrylate reaction intermediate and peptide inhibitor at the resolution of 2.25a
PDB Compounds: (X:) Cysteine synthase

SCOPe Domain Sequences for d4zu6x_:

Sequence, based on SEQRES records: (download)

>d4zu6x_ c.79.1.1 (X:) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]}
maiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtlt
kgkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgm
kgaiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtgg
sitgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldl
siidrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilps
aserylstalf

Sequence, based on observed residues (ATOM records): (download)

>d4zu6x_ c.79.1.1 (X:) O-acetylserine sulfhydrylase (Cysteine synthase) {Haemophilus influenzae [TaxId: 727]}
maiyadnsysigntplvrlkhfghngnvvvkiegrnpsysvkcriganmvwqaekdgtlt
kgkeivdatsgntgialayvaaargykitltmpetmslerkrllcglgvnlvltegakgg
aiakaeeivasdpsryvmlkqfenpanpqihrettgpeiwkdtdgkvdvvvagvgtggsi
tgisraikldfgkqitsvavepvespvisqtlageevkpgphkiqgigagfipknldlsi
idrvetvdsdtalatarrlmaeegilagissgaavaaadrlaklpefadklivvilpsas
erylstalf

SCOPe Domain Coordinates for d4zu6x_:

Click to download the PDB-style file with coordinates for d4zu6x_.
(The format of our PDB-style files is described here.)

Timeline for d4zu6x_:

  • d4zu6x_ is new in SCOPe 2.06-stable