Lineage for d4zhkb_ (4zhk B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2065823Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies)
    consists of seven 4-stranded beta-sheet motifs; meander
  4. 2066532Superfamily b.69.15: Retinal pigment epithelial membrane protein-like [310595] (1 family) (S)
    Pfam PF03055
  5. 2066533Family b.69.15.1: RPE65-like [310643] (2 protein domains)
  6. 2066561Protein automated matches [310886] (2 species)
    not a true protein
  7. 2066562Species Cow (Bos taurus) [TaxId:9913] [311375] (6 PDB entries)
  8. 2066564Domain d4zhkb_: 4zhk B: [310117]
    automated match to d3fsna_
    complexed with a8v, a9v, fe2, na, pg4, pge

Details for d4zhkb_

PDB Entry: 4zhk (more details), 2.09 Å

PDB Description: crystal structure of rpe65 in complex with mb-002
PDB Compounds: (B:) Retinoid isomerohydrolase

SCOPe Domain Sequences for d4zhkb_:

Sequence, based on SEQRES records: (download)

>d4zhkb_ b.69.15.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlf
dgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpdpcknifsrffs
yfrgvevtdnalvniypvgedyyactetnfitkvnpetletikqvdlcnyvsvngatahp
hiendgtvynigncfgknfsiaynivkipplqadkedpiskseivvqfpcsdrfkpsyvh
sfgltpnyivfvetpvkinlfkflsswslwganymdcfesnetmgvwlhiadkkrkkyin
nkyrtspfnlfhhintyedheflivdlccwkgfefvynylylanlrenweevkknarkap
qpevrryvlplnidkadtgknlvtlpnttatailcsdetiwlepevlfsgprqafefpqi
nyqkyggkpytyayglglnhfvpdrlcklnvktketwvwqepdsypsepifvshpdalee
ddgvvlsvvvspgagqkpayllilnakdlsevaraeveinipvtfhglfkks

Sequence, based on observed residues (ATOM records): (download)

>d4zhkb_ b.69.15.1 (B:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ssqvehpaggykklfetveelsspltahvtgriplwltgsllrcgpglfevgsepfyhlf
dgqallhkfdfkeghvtyhrrfirtdayvramtekrivitefgtcafpevtdnalvniyp
vgedyyactetnfitkvnpetletikqvdlcnyvsvngatahphiendgtvynigncfia
ynivkipplqadkedpiskseivvqfpcsdrfkpsyvhsfgltpnyivfvetpvkinlfk
flsswslwganymdcfesnetmgvwlhiadkkrkkyinnkyrtspfnlfhhintyedhef
livdlccwkgfefvynylylanlrenweevkknarkapqpevrryvlplnidkadtgknl
vtlpnttatailcsdetiwlepevlfsgprqafefpqinyqkyggkpytyayglglnhfv
pdrlcklnvktketwvwqepdsypsepifvshpdaleeddgvvlsvvvspgagqkpayll
ilnakdlsevaraeveinipvtfhglfkks

SCOPe Domain Coordinates for d4zhkb_:

Click to download the PDB-style file with coordinates for d4zhkb_.
(The format of our PDB-style files is described here.)

Timeline for d4zhkb_:

  • d4zhkb_ is new in SCOPe 2.06-stable