Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.18: DNA glycosylase [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: DNA glycosylase [52141] (2 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
Protein Uracil-DNA glycosylase [52143] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries) |
Domain d1emja_: 1emj A: [31011] complexed with asu, ura; mutant |
PDB Entry: 1emj (more details), 2 Å
SCOP Domain Sequences for d1emja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1emja_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens)} meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
Timeline for d1emja_: