Lineage for d1emja_ (1emj A:)
- Root: SCOP 1.59
Class c: Alpha and beta proteins (a/b) [51349] (113 folds) 
Fold c.18: DNA glycosylase [52140] (1 superfamily) Superfamily c.18.1: DNA glycosylase [52141] (2 families) 
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) Protein Uracil-DNA glycosylase [52143] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries) 
Domain d1emja_: 1emj A: [31011]
Details for d1emja_
PDB Entry: 1emj (more details), 2 Å
PDB Description: uracil-dna glycosylase bound to dna containing a 4'-thio- 2'deoxyuridine analog product
SCOP Domain Sequences for d1emja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1emja_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
SCOP Domain Coordinates for d1emja_:
Click to download the PDB-style file with coordinates for d1emja_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1emja_:
- d1emja_ first appeared (with stable ids) in SCOP 1.55
- d1emja_ appears in SCOP 1.57
- d1emja_ appears in SCOP 1.61
- d1emja_ appears in the current release, SCOPe 2.07
View in 3D