Lineage for d1emja_ (1emj A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21711Fold c.18: DNA glycosylase [52140] (1 superfamily)
  4. 21712Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 21713Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 21714Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 21733Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries)
  8. 21738Domain d1emja_: 1emj A: [31011]

Details for d1emja_

PDB Entry: 1emj (more details), 2 Å

PDB Description: uracil-dna glycosylase bound to dna containing a 4'-thio- 2'deoxyuridine analog product

SCOP Domain Sequences for d1emja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1emja_ c.18.1.1 (A:) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOP Domain Coordinates for d1emja_:

Click to download the PDB-style file with coordinates for d1emja_.
(The format of our PDB-style files is described here.)

Timeline for d1emja_: