Lineage for d4yvfa1 (4yvf A:4-189,A:353-432)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114715Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2116681Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 2116793Family c.23.12.3: S-adenosylhomocystein hydrolase [52300] (1 protein)
  6. 2116794Protein S-adenosylhomocystein hydrolase [52301] (3 species)
    contains additional secondary structures disguising the superfamily fold
  7. 2116795Species Human (Homo sapiens) [TaxId:9606] [52302] (3 PDB entries)
  8. 2116799Domain d4yvfa1: 4yvf A:4-189,A:353-432 [310109]
    Other proteins in same PDB: d4yvfa2, d4yvfb2
    automated match to d1li4a2
    complexed with nai, xfa

Details for d4yvfa1

PDB Entry: 4yvf (more details), 2.7 Å

PDB Description: structure of s-adenosyl-l-homocysteine hydrolase
PDB Compounds: (A:) Adenosylhomocysteinase

SCOPe Domain Sequences for d4yvfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yvfa1 c.23.12.3 (A:4-189,A:353-432) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]}
klpykvadiglaawgrkaldiaenempglmrmrerysaskplkgariagclhmtvetavl
ietlvtlgaevqwsscnifstqdhaaaaiakagipvyawkgetdeeylwcieqtlyfkdg
plnmilddggdltnlihtkypqllpgirgiseetttgvhnlykmmangilkvpainvnds
vtkskfXhpsfvmsnsftnqvmaqielwthpdkypvgvhflpkkldeavaeahlgklnvk
ltkltekqaqylgmscdgpfkpdhyry

SCOPe Domain Coordinates for d4yvfa1:

Click to download the PDB-style file with coordinates for d4yvfa1.
(The format of our PDB-style files is described here.)

Timeline for d4yvfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yvfa2