Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.8: Rv2717c-like [141475] (3 proteins) bacterial and plant proteins with a fatty acid binding protein-like fold automatically mapped to Pfam PF08768 |
Protein Hypothetical protein At1g79260 [141478] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [141479] (5 PDB entries) Uniprot O64527 14-166 |
Domain d4ymya_: 4ymy A: [310107] automated match to d3wjeb_ complexed with gol; mutant |
PDB Entry: 4ymy (more details), 1 Å
SCOPe Domain Sequences for d4ymya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ymya_ b.60.1.8 (A:) Hypothetical protein At1g79260 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} ppvhpfvaplsyllgtwrgqgegeyptipsfrygeeirfshsgkpviaytqktwklesga palaesgyfrprpdgsievviacstglvevqkgtynvdeqsiklksdlvgnaskvkeisr efelvdgklsyvvrlstttnplqpalkaildkl
Timeline for d4ymya_: