Lineage for d4y6qa_ (4y6q A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2444630Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2444631Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2444911Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 protein domains)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2444971Protein Sirt2 histone deacetylase [63987] (1 species)
  7. 2444972Species Human (Homo sapiens) [TaxId:9606] [63988] (15 PDB entries)
  8. 2444988Domain d4y6qa_: 4y6q A: [310100]
    automated match to d1j8fc_
    complexed with omr, zn

Details for d4y6qa_

PDB Entry: 4y6q (more details), 1.9 Å

PDB Description: human sirt2 in complex with 2-o-myristoyl-adp-ribose
PDB Compounds: (A:) nad-dependent protein deacetylase sirtuin-2

SCOPe Domain Sequences for d4y6qa_:

Sequence, based on SEQRES records: (download)

>d4y6qa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]}
erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp
eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekaggggm
dfdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq

Sequence, based on observed residues (ATOM records): (download)

>d4y6qa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]}
erlldeltlegvarymqsercrrviclvgagistsagipdfrspstglydnlekyhlpyp
eaifeisyfkkhpepffalakelypgqfkptichyfmrllkdkglllrcytqnidtleri
agleqedlveahgtfytshcvsascrheyplswmkekifsevtpkcedcqslvkpdivff
geslparffscmqsdflkvdlllvmgtslqvqpfasliskaplstprllinkekagggmd
fdskkayrdvawlgecdqgclalaellgwkkeledlvrrehasidaq

SCOPe Domain Coordinates for d4y6qa_:

Click to download the PDB-style file with coordinates for d4y6qa_.
(The format of our PDB-style files is described here.)

Timeline for d4y6qa_: