SCOPe 2.07: Domain d1ughe1: 1ugh E:85-304

Lineage for d1ughe1 (1ugh E:85-304)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (16 PDB entries)

8. Domain d1ughe1: 1ugh E:85-304 [31010]
   Other proteins in same PDB: d1ughe2, d1ughi_
   protein/DNA complex

Details for d1ughe1

PDB Entry: 1ugh, 1.9 Å

PDB Description: crystal structure of human uracil-dna glycosylase in complex with a protein inhibitor: protein mimicry of dna

PDB Compounds: (E:) protein (uracil-DNA glycosylase)

SCOPe Domain Sequences for d1ughe1:

Sequence; same for both SEQRES and ATOM records:

>d1ughe1 c.18.1.1 (E:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d1ughe1:

• d1ughe1 first appeared (with stable ids) in SCOP 1.55, called d1ughe_
  
• d1ughe1 appears in SCOPe 2.06
  
• d1ughe1 appears in the current release, SCOPe 2.08