Lineage for d1ughe_ (1ugh E:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586283Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 1586284Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) (S)
  5. 1586285Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)
  6. 1586286Protein Uracil-DNA glycosylase [52143] (5 species)
  7. 1586329Species Human (Homo sapiens) [TaxId:9606] [52144] (14 PDB entries)
  8. 1586338Domain d1ughe_: 1ugh E: [31010]
    Other proteins in same PDB: d1ughi_
    protein/DNA complex

Details for d1ughe_

PDB Entry: 1ugh (more details), 1.9 Å

PDB Description: crystal structure of human uracil-dna glycosylase in complex with a protein inhibitor: protein mimicry of dna
PDB Compounds: (E:) protein (uracil-DNA glycosylase)

SCOPe Domain Sequences for d1ughe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ughe_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOPe Domain Coordinates for d1ughe_:

Click to download the PDB-style file with coordinates for d1ughe_.
(The format of our PDB-style files is described here.)

Timeline for d1ughe_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ughi_