| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.18: DNA glycosylase [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: DNA glycosylase [52141] (3 families) ![]() |
| Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) |
| Protein Uracil-DNA glycosylase [52143] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries) |
| Domain d1ughe_: 1ugh E: [31010] Other proteins in same PDB: d1ughi_ mutant |
PDB Entry: 1ugh (more details), 1.9 Å
SCOP Domain Sequences for d1ughe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ughe_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
Timeline for d1ughe_: