SCOP 1.59: Domain d1ughe_: 1ugh E:

Lineage for d1ughe_ (1ugh E:)

1. Root: SCOP 1.59

2. Class c: Alpha and beta proteins (a/b) [51349] (113 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)

4. Superfamily c.18.1: DNA glycosylase [52141] (2 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries)

8. Domain d1ughe_: 1ugh E: [31010]
   Other proteins in same PDB: d1ughi_

Details for d1ughe_

PDB Entry: 1ugh, 1.9 Å

PDB Description: crystal structure of human uracil-dna glycosylase in complex with a protein inhibitor: protein mimicry of dna

SCOP Domain Sequences for d1ughe_:

Sequence; same for both SEQRES and ATOM records:

>d1ughe_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d1ughe_:

• d1ughe_ first appeared (with stable ids) in SCOP 1.55
  
• d1ughe_ appears in SCOP 1.57
  
• d1ughe_ appears in SCOP 1.61
  
• d1ughe_ appears in the current release, SCOPe 2.08, called d1ughe1