Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.0: automated matches [191672] (1 protein) not a true family |
Protein automated matches [191281] (21 species) not a true protein |
Species Mycobacterium abscessus [TaxId:561007] [311480] (1 PDB entry) |
Domain d4y0eg_: 4y0e G: [310098] Other proteins in same PDB: d4y0ed2, d4y0ee2 automated match to d4j5if_ complexed with epe, fe, mpd, mrd |
PDB Entry: 4y0e (more details), 1.9 Å
SCOPe Domain Sequences for d4y0eg_:
Sequence, based on SEQRES records: (download)
>d4y0eg_ b.82.2.0 (G:) automated matches {Mycobacterium abscessus [TaxId: 561007]} tddqtrriyrdagitveklgehigarvngielrgdlsadrveairlalainkvlvfteqh hlddagqyafarllgeptlphptvrshgtellnlegaangwhtdvtfvdripkasvlrpv tlpsyggattwastvaayeqlpkplrslvddlwathtnlydyassgasggvsaerraayy teftssryetvhpvvrvhpetgerslllgqfvksfqdlpsaefaslfqllqaritklent frwnwrlgdvaiwdnratqhygiadfgeqqrelhrvtlagdvpvdvhgrrsqillgdash ysgietpqrlelfa
>d4y0eg_ b.82.2.0 (G:) automated matches {Mycobacterium abscessus [TaxId: 561007]} tddqtrriyrdagitveklgehigarvngielrgdlsadrveairlalainkvlvfteqh hlddagqyafarllgeptlphptvrshgtellnlegaangwhtdvtfvdripkasvlrpv tlpsyggattwastvaayeqlpkplrslvddlwathtnlyaerraayyteftssryetvh pvvrvhpetgerslllgqfvksfqdlpsaefaslfqllqaritklentfrwnwrlgdvai wdnratqhygiadfgeqqrelhrvtlagdvpvdvhgrrsqillgdashysgietpqrlel fa
Timeline for d4y0eg_: