Lineage for d4y0eb_ (4y0e B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2070014Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2070786Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2071232Family b.82.2.0: automated matches [191672] (1 protein)
    not a true family
  6. 2071233Protein automated matches [191281] (13 species)
    not a true protein
  7. 2071257Species Mycobacterium abscessus [TaxId:561007] [311480] (1 PDB entry)
  8. 2071259Domain d4y0eb_: 4y0e B: [310091]
    Other proteins in same PDB: d4y0ed2, d4y0ee2
    automated match to d4j5if_
    complexed with epe, fe, mpd, mrd

Details for d4y0eb_

PDB Entry: 4y0e (more details), 1.9 Å

PDB Description: x-ray crystal structure of a putative dioxygenase from mycobacterium abscessus
PDB Compounds: (B:) Putative dioxygenase

SCOPe Domain Sequences for d4y0eb_:

Sequence, based on SEQRES records: (download)

>d4y0eb_ b.82.2.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
tddqtrriyrdagitveklgehigarvngielrgdlsadrveairlalainkvlvfteqh
hlddagqyafarllgeptlphptvrshgtellnlegaangwhtdvtfvdripkasvlrpv
tlpsyggattwastvaayeqlpkplrslvddlwathtnlydyassgasggvsaerraayy
teftssryetvhpvvrvhpetgerslllgqfvksfqdlpsaefaslfqllqaritklent
frwnwrlgdvaiwdnratqhygiadfgeqqrelhrvtlagdvpvdvhgrrsqillgdash
ysgietpqrlelf

Sequence, based on observed residues (ATOM records): (download)

>d4y0eb_ b.82.2.0 (B:) automated matches {Mycobacterium abscessus [TaxId: 561007]}
tddqtrriyrdagitveklgehigarvngielrgdlsadrveairlalainkvlvfteqh
hlddagqyafarllgeptlphptvrshgtellnlegaangwhtdvtfvdripkasvlrpv
tlpsyggattwastvaayeqlpkplrslvddlwathtnlyaayyteftssryetvhpvvr
vhpetgerslllgqfvksfqdlpsaefaslfqllqaritklentfrwnwrlgdvaiwdnr
atqhygiadfgeqqrelhrvtlagdvpvdvhgrrsqillgdashysgietpqrlelf

SCOPe Domain Coordinates for d4y0eb_:

Click to download the PDB-style file with coordinates for d4y0eb_.
(The format of our PDB-style files is described here.)

Timeline for d4y0eb_:

  • d4y0eb_ is new in SCOPe 2.06-stable