SCOP 1.57: Domain d1sspe_: 1ssp E:

Lineage for d1sspe_ (1ssp E:)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.18: DNA glycosylase [52140] (1 superfamily)

4. Superfamily c.18.1: DNA glycosylase [52141] (2 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)

6. Protein Uracil-DNA glycosylase [52143] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries)

8. Domain d1sspe_: 1ssp E: [31009]

Details for d1sspe_

PDB Entry: 1ssp, 1.9 Å

PDB Description: wild-type uracil-dna glycosylase bound to uracil-containing dna

SCOP Domain Sequences for d1sspe_:

Sequence; same for both SEQRES and ATOM records:

>d1sspe_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d1sspe_:

• d1sspe_ first appeared (with stable ids) in SCOP 1.55
  
• d1sspe_ appears in SCOP 1.59
  
• d1sspe_ appears in the current release, SCOPe 2.08, called d1sspe1