Lineage for d1sspe_ (1ssp E:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21711Fold c.18: DNA glycosylase [52140] (1 superfamily)
  4. 21712Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 21713Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 21714Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 21733Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries)
  8. 21736Domain d1sspe_: 1ssp E: [31009]

Details for d1sspe_

PDB Entry: 1ssp (more details), 1.9 Å

PDB Description: wild-type uracil-dna glycosylase bound to uracil-containing dna

SCOP Domain Sequences for d1sspe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sspe_ c.18.1.1 (E:) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOP Domain Coordinates for d1sspe_:

Click to download the PDB-style file with coordinates for d1sspe_.
(The format of our PDB-style files is described here.)

Timeline for d1sspe_: