SCOPe 2.07: Domain d1sspe1: 1ssp E:85-304

Lineage for d1sspe1 (1ssp E:85-304)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52144] (15 PDB entries)

8. Domain d1sspe1: 1ssp E:85-304 [31009]
   Other proteins in same PDB: d1sspe2
   protein/DNA complex; complexed with ura

Details for d1sspe1

PDB Entry: 1ssp, 1.9 Å

PDB Description: wild-type uracil-dna glycosylase bound to uracil-containing dna

PDB Compounds: (E:) uracil-DNA glycosylase

SCOPe Domain Sequences for d1sspe1:

Sequence; same for both SEQRES and ATOM records:

>d1sspe1 c.18.1.1 (E:85-304) Uracil-DNA glycosylase {Human (Homo sapiens) [TaxId: 9606]}
fgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvilgq
dpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvllln
avltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhhvl
qtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

Timeline for d1sspe1:

• d1sspe1 first appeared (with stable ids) in SCOP 1.55, called d1sspe_
  
• d1sspe1 appears in SCOPe 2.06