Lineage for d4xxpa_ (4xxp A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781202Species Mycobacterium paratuberculosis [TaxId:262316] [311482] (1 PDB entry)
  8. 2781203Domain d4xxpa_: 4xxp A: [310088]
    automated match to d2hyka_
    complexed with mg

Details for d4xxpa_

PDB Entry: 4xxp (more details), 1.6 Å

PDB Description: crystal structure of an uncharacterized protein (rv0315 ortholog) from mycobacterium paratuberculosis
PDB Compounds: (A:) Putative uncharacterized protein (Rv0315 ortholog)

SCOPe Domain Sequences for d4xxpa_:

Sequence, based on SEQRES records: (download)

>d4xxpa_ b.29.1.0 (A:) automated matches {Mycobacterium paratuberculosis [TaxId: 262316]}
ylfqdefdgpagsapdaskwavakaretikdptywerpenigqyrddrrnvfldgksnlv
lraakngptyysgkvqslwrggvghtwearikldcltagawpaywlgnddqgeidvmewy
gngnwpsattvhakanggewkthniavdsawhtwrcqwdeagirfwkdyvdgaqpyfdvp
asslpdwpfngpgytvfpvfnlavagsgggdpgpgsypadmlidwirvw

Sequence, based on observed residues (ATOM records): (download)

>d4xxpa_ b.29.1.0 (A:) automated matches {Mycobacterium paratuberculosis [TaxId: 262316]}
ylfqdefdgpagsapdaskwavakqyrddrrnvfldgksnlvlraakngptyysgkvqsl
wrggvghtwearikldcltagawpaywlgnddqgeidvmewygngnwpsattvhakewkt
hniavdsawhtwrcqwdeagirfwkdyvdgaqpyfdvpasslpdwpfngpgytvfpvfnl
avagsgggdpgpgsypadmlidwirvw

SCOPe Domain Coordinates for d4xxpa_:

Click to download the PDB-style file with coordinates for d4xxpa_.
(The format of our PDB-style files is described here.)

Timeline for d4xxpa_: