Lineage for d4xx4b_ (4xx4 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2392462Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2392953Protein Chymosin (synonym: renin) [50667] (3 species)
  7. 2392961Species Human (Homo sapiens) [TaxId:9606] [50669] (76 PDB entries)
  8. 2393069Domain d4xx4b_: 4xx4 B: [310085]
    automated match to d2rena_
    complexed with 70y, nag

Details for d4xx4b_

PDB Entry: 4xx4 (more details), 2.4 Å

PDB Description: renin in complex with (4s)-4-isopropyl-4-methyl-6-oxo-1-(3-(2-oxo-4- phenylpyrrolidin-1-yl)benzyl)tetrahydropyrimidin-2(1h)-iminium
PDB Compounds: (B:) renin

SCOPe Domain Sequences for d4xx4b_:

Sequence, based on SEQRES records: (download)

>d4xx4b_ b.50.1.2 (B:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdsensqslggqivlgg
sdpqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssie
klmealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlai
hamdippptgptwalgatfirkfytefdrrnnrigfalar

Sequence, based on observed residues (ATOM records): (download)

>d4xx4b_ b.50.1.2 (B:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]}
ltlgnttssviltnymdtqyygeigigtppqtfkvvfdtgssnvwvpsskcsrlytacvy
hklfdasdsssykhngteltlrystgtvsgflsqdiitvggitvtqmfgevtempalpfm
laefdgvvgmgfieqaigrvtpifdniisqgvlkedvfsfyynrdssqslggqivlggsd
pqhyegnfhyinliktgvwqiqmkgvsvgsstllcedgclalvdtgasyisgstssiekl
mealgakkrlfdyvvkcnegptlpdisfhlggkeytltsadyvfqesysskklctlaiha
mdippptgptwalgatfirkfytefdrrnnrigfalar

SCOPe Domain Coordinates for d4xx4b_:

Click to download the PDB-style file with coordinates for d4xx4b_.
(The format of our PDB-style files is described here.)

Timeline for d4xx4b_: