Lineage for d4xwab_ (4xwa B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114714Species Staphylococcus aureus [TaxId:418127] [311481] (1 PDB entry)
  8. 2114716Domain d4xwab_: 4xwa B: [310081]
    automated match to d2ccgb_
    complexed with 43n

Details for d4xwab_

PDB Entry: 4xwa (more details), 1.89 Å

PDB Description: TMK from S.aureus in complex with the Piperidinyl Thymine class inhibitor with a C5 ethyl-amine
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d4xwab_:

Sequence, based on SEQRES records: (download)

>d4xwab_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 418127]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknsrdqnrldqedlkfhekviegyqeiihnesqrfksv
nadqplenvvedtyqtiikyleki

Sequence, based on observed residues (ATOM records): (download)

>d4xwab_ c.37.1.0 (B:) automated matches {Staphylococcus aureus [TaxId: 418127]}
safitfegpegsgkttvinevyhrlvkdydvimtrepggvptgeeirkivlegndmdirt
eamlfaasrrehlvlkvipalkegkvvlcdryidsslayqgyargigveevralnefain
glypdltiylnvsaevgreriiknldqedlkfhekviegyqeiihnesqrfksvnadqpl
envvedtyqtiikyleki

SCOPe Domain Coordinates for d4xwab_:

Click to download the PDB-style file with coordinates for d4xwab_.
(The format of our PDB-style files is described here.)

Timeline for d4xwab_:

  • d4xwab_ is new in SCOPe 2.06-stable