Lineage for d1akz__ (1akz -)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.18: DNA glycosylase [52140] (1 superfamily)
3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134Superfamily c.18.1: DNA glycosylase [52141] (3 families) 
Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein) Protein Uracil-DNA glycosylase [52143] (4 species) 
Species Human (Homo sapiens) [TaxId:9606] [52144] (8 PDB entries) 
Domain d1akz__: 1akz - [31007]
mutant
Details for d1akz__
PDB Entry: 1akz (more details), 1.57 Å
PDB Description: human uracil-dna glycosylase
SCOP Domain Sequences for d1akz__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1akz__ c.18.1.1 (-) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
SCOP Domain Coordinates for d1akz__:
Click to download the PDB-style file with coordinates for d1akz__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1akz__:
- d1akz__ first appeared (with stable ids) in SCOP 1.55
- d1akz__ appears in SCOP 1.69
- d1akz__ is called d1akza_ in SCOP 1.73
- d1akz__ appears in the current release, SCOPe 2.08, called d1akza1
View in 3D