Lineage for d1akz__ (1akz -)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 240918Fold c.18: DNA glycosylase [52140] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134
  4. 240919Superfamily c.18.1: DNA glycosylase [52141] (2 families) (S)
  5. 240920Family c.18.1.1: Uracil-DNA glycosylase [52142] (1 protein)
  6. 240921Protein Uracil-DNA glycosylase [52143] (3 species)
  7. 240950Species Human (Homo sapiens) [TaxId:9606] [52144] (7 PDB entries)
  8. 240951Domain d1akz__: 1akz - [31007]
    mutant

Details for d1akz__

PDB Entry: 1akz (more details), 1.57 Å

PDB Description: human uracil-dna glycosylase

SCOP Domain Sequences for d1akz__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1akz__ c.18.1.1 (-) Uracil-DNA glycosylase {Human (Homo sapiens)}
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel

SCOP Domain Coordinates for d1akz__:

Click to download the PDB-style file with coordinates for d1akz__.
(The format of our PDB-style files is described here.)

Timeline for d1akz__: