Lineage for d4xseb_ (4xse B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2212073Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2212074Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2212075Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2212382Protein automated matches [190469] (15 species)
    not a true protein
  7. 2212566Species Varicella-zoster virus (strain oka vaccine) [TaxId:341980] [311478] (3 PDB entries)
  8. 2212576Domain d4xseb_: 4xse B: [310062]
    automated match to d4ez8a_
    complexed with po4

Details for d4xseb_

PDB Entry: 4xse (more details), 3.1 Å

PDB Description: complex structure of thymidylate synthase from varicella zoster virus
PDB Compounds: (B:) Thymidylate synthase

SCOPe Domain Sequences for d4xseb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xseb_ d.117.1.1 (B:) automated matches {Varicella-zoster virus (strain oka vaccine) [TaxId: 341980]}
gelqylkqvddilrygvrkrdrtgigtlslfgmqarynlrnefpllttkrvfwravveel
lwfirgstdskelaakdihiwdiygsskflnrngfhkrhtgdlgpiygfqwrhfgaeykd
cqsnylqqgidqlqtvidtiktnpesrrmiisswnpkdiplmvlppchtlcqfyvangel
scqvyqrsgdmglgvpfniagyalltyivahvtglktgdlihtmgdahiylnhidalkvq
larspkpfpclkiirnvtdindfkwddfqldgynphppl

SCOPe Domain Coordinates for d4xseb_:

Click to download the PDB-style file with coordinates for d4xseb_.
(The format of our PDB-style files is described here.)

Timeline for d4xseb_: