![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) ![]() automatically mapped to Pfam PF00303 |
![]() | Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
![]() | Protein automated matches [190469] (17 species) not a true protein |
![]() | Species Varicella-zoster virus (strain oka vaccine) [TaxId:341980] [311478] (3 PDB entries) |
![]() | Domain d4xseb_: 4xse B: [310062] automated match to d4ez8a_ complexed with po4 |
PDB Entry: 4xse (more details), 3.1 Å
SCOPe Domain Sequences for d4xseb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4xseb_ d.117.1.1 (B:) automated matches {Varicella-zoster virus (strain oka vaccine) [TaxId: 341980]} gelqylkqvddilrygvrkrdrtgigtlslfgmqarynlrnefpllttkrvfwravveel lwfirgstdskelaakdihiwdiygsskflnrngfhkrhtgdlgpiygfqwrhfgaeykd cqsnylqqgidqlqtvidtiktnpesrrmiisswnpkdiplmvlppchtlcqfyvangel scqvyqrsgdmglgvpfniagyalltyivahvtglktgdlihtmgdahiylnhidalkvq larspkpfpclkiirnvtdindfkwddfqldgynphppl
Timeline for d4xseb_: