Lineage for d4xsea_ (4xse A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2972108Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
    contains large mixed beta-sheet
  4. 2972109Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) (S)
    automatically mapped to Pfam PF00303
  5. 2972110Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
  6. 2972567Protein automated matches [190469] (17 species)
    not a true protein
  7. 2972752Species Varicella-zoster virus (strain oka vaccine) [TaxId:341980] [311478] (3 PDB entries)
  8. 2972761Domain d4xsea_: 4xse A: [310061]
    automated match to d4ez8a_
    complexed with po4

Details for d4xsea_

PDB Entry: 4xse (more details), 3.1 Å

PDB Description: complex structure of thymidylate synthase from varicella zoster virus
PDB Compounds: (A:) Thymidylate synthase

SCOPe Domain Sequences for d4xsea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xsea_ d.117.1.1 (A:) automated matches {Varicella-zoster virus (strain oka vaccine) [TaxId: 341980]}
tgelqylkqvddilrygvrkrdrtgigtlslfgmqarynlrnefpllttkrvfwravvee
llwfirgstdskelaakdihiwdiygsskflnrngfhkrhtgdlgpiygfqwrhfgaeyk
dcqsnylqqgidqlqtvidtiktnpesrrmiisswnpkdiplmvlppchtlcqfyvange
lscqvyqrsgdmglgvpfniagyalltyivahvtglktgdlihtmgdahiylnhidalkv
qlarspkpfpclkiirnvtdindfkwddfqldgynphpp

SCOPe Domain Coordinates for d4xsea_:

Click to download the PDB-style file with coordinates for d4xsea_.
(The format of our PDB-style files is described here.)

Timeline for d4xsea_: