Lineage for d1cvra2 (1cvr A:1-350)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2854798Fold c.17: Caspase-like [52128] (1 superfamily)
    3 layers, a/b/a; core: mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest
  4. 2854799Superfamily c.17.1: Caspase-like [52129] (3 families) (S)
    mature protein may be composed of two chains folded in a single domain
  5. 2854966Family c.17.1.2: Gingipain R (RgpB), N-terminal domain [52137] (2 proteins)
    contains extra N-terminal alpha/beta subdomain
    automatically mapped to Pfam PF01364
  6. 2854967Protein Gingipain R (RgpB), N-terminal domain [52138] (1 species)
    Arginine-specific cysteine proteinase
  7. 2854968Species Porphyromonas gingivalis [TaxId:837] [52139] (1 PDB entry)
  8. 2854969Domain d1cvra2: 1cvr A:1-350 [31006]
    Other proteins in same PDB: d1cvra1
    complexed with ca, h37, zn

Details for d1cvra2

PDB Entry: 1cvr (more details), 2 Å

PDB Description: Crystal structure of the Arg specific cysteine proteinase gingipain R (RGPB)
PDB Compounds: (A:) gingipain r

SCOPe Domain Sequences for d1cvra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cvra2 c.17.1.2 (A:1-350) Gingipain R (RgpB), N-terminal domain {Porphyromonas gingivalis [TaxId: 837]}
ytpveekengrmivivakkyegdikdfvdwknqrglrtevkvaediaspvtanaiqqfvk
qeyekegndltyvllvgdhkdipakitpgiksdqvygqivgndhynevfigrfscesked
lktqidrtihyernittedkwlgqalciasaeggpsadngesdiqhenvianlltqygyt
kiikcydpgvtpkniidafnggislvnytghgsetawgtshfgtthvkqltnsnqlpfif
dvacvngdflfsmpcfaealmraqkdgkptgtvaiiastidqywappmrgqdemneilce
khpnnikrtfggvtmngmfamvekykkdgenmldtwtvfgdpsllvrtlv

SCOPe Domain Coordinates for d1cvra2:

Click to download the PDB-style file with coordinates for d1cvra2.
(The format of our PDB-style files is described here.)

Timeline for d1cvra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cvra1