SCOPe 2.08: Domain d4xllb_: 4xll B:

Lineage for d4xllb_ (4xll B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.0: automated matches [191336] (1 protein)
   not a true family

6. Protein automated matches [190197] (23 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [311477] (1 PDB entry)

8. Domain d4xllb_: 4xll B: [310052]
   automated match to d4e08a_

Details for d4xllb_

PDB Entry: 4xll, 2.08 Å

PDB Description: toxoplasma gondii dj-1, oxidized

PDB Compounds: (B:) DJ-1 family protein

SCOPe Domain Sequences for d4xllb_:

Sequence; same for both SEQRES and ATOM records:

>d4xllb_ c.23.16.0 (B:) automated matches {Toxoplasma gondii [TaxId: 5811]}
avkvlvpvahdseeieavsiidtlrragaevvvasvedteivrmsrgvcvkadklisave
netydciaipggmpgaercrdsaaltamlkthkaqgkliaaicaspavvlqthgllqgek
avaypcfmdqfpadmrgegrvcvsnkivtsvgpssaiefalklievlynkeqakkiaaql
lyay

Timeline for d4xllb_:

• d4xllb_ first appeared in SCOPe 2.06
  
• d4xllb_ appears in SCOPe 2.07